PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on 201420 FitnessBrowser__MR1:201420 (299 amino acids)

SeqID: 201420 FitnessBrowser__MR1:201420
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Cytoplasmic                   [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Cytoplasmic                   [matched 15600390: ribosomal protein S6 modification protein[Pseudomonas aeruginosa PAO1]]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    Cytoplasmic            9.97
    Periplasmic            0.01
    CytoplasmicMembrane    0.01
    Extracellular          0.00
    OuterMembrane          0.00
  Final Prediction:
    Cytoplasmic            9.97

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>201420 FitnessBrowser__MR1:201420
MRIAILSQGPELYSTKRLVEAATLRGHEVKVINPLECYMNINMRQSSIHIGGEELPPFDA
VIPRIGASITFYGSAVLRQFEMMGVYALNDSVGISRSRDKLRSMQLMSRRGIGLPITGFA
NKPSDIPDLIDMVGGAPLVIKLLEGTQGIGVVLAETRKAAESVIEAFMGLKANIMVQEYI
KEANGADIRCFVLGDKVVAAMKRQAMPGEFRSNLHRGGTASLVKLTPEERSVAIRAAKTM
GLNVAGVDLLRSNHGPLVMEVNSSPGLEGIEGATAKDVAGAIIEFVEKNALKTKKPTQA