PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on 207025 MicrobesOnline__882:207025 (312 amino acids)

SeqID: 207025 MicrobesOnline__882:207025
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Cytoplasmic                   [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Cytoplasmic                   [matched 67466690: Ribose-phosphate pyrophosphokinase]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    Cytoplasmic            9.97
    Periplasmic            0.01
    CytoplasmicMembrane    0.01
    Extracellular          0.00
    OuterMembrane          0.00
  Final Prediction:
    Cytoplasmic            9.97

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>207025 MicrobesOnline__882:207025
MQGDLKILTGTSNPELAKAICNHLGCQITPALCETFSDGEIRIEIGDNVRGDDVFVVQAT
CAPVNFNLMQLFLMLDALKRASAGRVTAVMPYYGYARQDRKVSPRAPISAKLVADFLTTA
GTDRVVTVDLHAGQIQGFFNSPVDNLYAAPVILDYLRQVEGEIVIVSPDAGGVERARAYA
KRLNAGLAIVDKRRDKPNQAQAMHVIGDVRDKVAIVVDDMIDTAGTLCAAGEVLLKNGAR
EVMACATHPVLSGPAIERLCNSPFKQVIVTDTVPLGDKLNACPKLHVLSVAGLLAKAIHN
IHTESSVSVLFV

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory