PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on 208073 MicrobesOnline__882:208073 (321 amino acids)

SeqID: 208073 MicrobesOnline__882:208073
  Analysis Report:
    CMSVM-            CytoplasmicMembrane           [No details]
    CytoSVM-          Cytoplasmic                   [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        CytoplasmicMembrane           [matched 1168475: Oligopeptide transport ATP-binding protein appD]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    CytoplasmicMembrane    9.99
    Cytoplasmic            0.01
    Periplasmic            0.00
    Extracellular          0.00
    OuterMembrane          0.00
  Final Prediction:
    CytoplasmicMembrane    9.99

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>208073 MicrobesOnline__882:208073
MTTPLLEVQGLDVVFDIEAGAIHAVRDVSFTLPHGRTLCIVGESGCGKSMTALALLGLVP
APGRVTARRLQFDGHDLTALDENGLRALRGHHMAMVFQDPMTSLNPVFRVGDQVAEALRL
HLRLKGRAAREATIELFRQVGIPSPETRYDDYPHQLSGGMRQRVMIAMALSCGPRLLIAD
EPTTALDVTIQGQILGLLSDIAATGRASVLLITHDLGVVAETADDVIVMYAGAIVEHAPV
QELFASPLHPYTRGLMRSAPPVHGERSPRLEAIRGNVPPLDDLPSGCAFRDRCEHAFERC
ATAAPPLFTLGKQMVRCWLHA

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory