PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on 209043 MicrobesOnline__882:209043 (126 amino acids)

SeqID: 209043 MicrobesOnline__882:209043
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Cytoplasmic                   [matched 20141330: Histidine biosynthesis bifunctional protein hisIE]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    Cytoplasmic            9.26
    Periplasmic            0.48
    CytoplasmicMembrane    0.24
    OuterMembrane          0.01
    Extracellular          0.01
  Final Prediction:
    Cytoplasmic            9.26

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>209043 MicrobesOnline__882:209043
MTAFVPDFGKAGGLVPAIAQDADTGEVLMMAWMNAEAFEMTLKTGEAHYFSRSRGRLWHK
GGTSGHTQHIRAVRLDCDSDTILLLVEQRGGAACHEGYRSCFYREMKDGEVSICSPKVFD
PKEVYK