PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on 209274 DVU0340 acetyltransferase, CysE/LacA/LpxA/NodL family (197 amino acids)

SeqID: 209274 DVU0340 acetyltransferase, CysE/LacA/LpxA/NodL family
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Cytoplasmic                   [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [1 internal helix found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Cytoplasmic                   [matched 135739: Cytoplasmic protein]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    Cytoplasmic            9.97
    Periplasmic            0.01
    CytoplasmicMembrane    0.01
    Extracellular          0.00
    OuterMembrane          0.00
  Final Prediction:
    Cytoplasmic            9.97

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>209274 DVU0340 acetyltransferase, CysE/LacA/LpxA/NodL family
MARCAVFLEELWFALFAWVPTVLGTAVRLVAWRPLFRLLGGVCGKVRFGQSLTLQGAGHM
RLADGVRLGKGCHLYARTGELVMGENAALNINVVVDADGGTVRIGAHATVGPGTVIRAAN
HRFDRLDTPIMFQGHEYGEVVIDDDVWIAANCTVVPGVHIGRGAVVGAGAVVTKDVEPYT
VVAGVPARFIRRRGPAE

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory