PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on 209277 FitnessBrowser__DvH:209277 (260 amino acids)

SeqID: 209277 FitnessBrowser__DvH:209277
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Cytoplasmic                   [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Cytoplasmic                   [matched 15599323: conserved hypothetical protein[Pseudomonas aeruginosa PAO1]]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    Cytoplasmic            9.97
    Periplasmic            0.01
    CytoplasmicMembrane    0.01
    Extracellular          0.00
    OuterMembrane          0.00
  Final Prediction:
    Cytoplasmic            9.97

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>209277 FitnessBrowser__DvH:209277
MTTAHDIRSKMQRGEATIGTWMQLPSTDVAEILGRAGYDWVAVDLEHAAFTRAMLPDLFR
AIELGGTAPFARVAEATLTDIKAALDSGAHGIIFPMIETREQLDAAIGWALYPRTDGPSG
IRGVGYCRGNLFGREFDAYRNTTARDLVFVAQIEHIRAVENLDAILAHPRLDAIMVGPYD
LSGSMGLTAQFDHPDFKAALDRIRDKAVAHGVPMGLHIVQPDEALVRAKVAEGYRFIAYG
IDAVFLYHGAQCPAPTAERK

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory