PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on 351657 FitnessBrowser__Btheta:351657 (345 amino acids)

SeqID: 351657 FitnessBrowser__Btheta:351657
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Cytoplasmic                   [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Cytoplasmic                   [matched PS50862: AA_TRNA_LIGASE_II Profile - Cytoplasmic ]
    SCL-BLAST-        Cytoplasmic                   [matched 116241259: Aspartate--ammonia ligase]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    Cytoplasmic            10.00
    Periplasmic            0.00
    CytoplasmicMembrane    0.00
    Extracellular          0.00
    OuterMembrane          0.00
  Final Prediction:
    Cytoplasmic            10.00

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>351657 FitnessBrowser__Btheta:351657
MSYLIKPKNYKPLLDLKQTELGIKQIKEFFQLNLSSELRLRRVTAPLFVLKGMGINDDLN
GIERPVSFPIKDLGDAQAEVVHSLAKWKRLTLADYNIEPGYGIYTDMNAIRSDEELGNLH
SLYVDQWDWERVITNEDRNVEFLKEIVNRIYAAMIRTEYMVYEMYPQIKPCLPQKLHFIH
SEELRQLYPNLEPKCREHAICQKYGAVFIIGIGCKLSDGKKHDGRAPDYDDYTSTGLNNL
PGLNGDLLLWDDVLQRSIELSSMGVRVDREALQRQLKEENEEERLKLYFHKRLMDDTLPL
SIGGGIGQSRLCMFYLRKAHIGEIQASIWPEDMRKECEELDIHLI

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory