PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on 3606888 Dshi_0318 cationic amino acid ABC transporter, periplasmic binding protein (RefSeq) (338 amino acids)

SeqID: 3606888 Dshi_0318 cationic amino acid ABC transporter, periplasmic binding protein (RefSeq)
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [1 internal helix found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Periplasmic                   [matched 3182887: Periplasmic protein]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Non-Cytoplasmic               [Signal peptide detected]
  Localization Scores:
    Periplasmic            9.76
    Extracellular          0.11
    CytoplasmicMembrane    0.06
    OuterMembrane          0.06
    Cytoplasmic            0.00
  Final Prediction:
    Periplasmic            9.76

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>3606888 Dshi_0318 cationic amino acid ABC transporter, periplasmic binding protein (RefSeq)
MKKSVLFGALAAAGLAATGAAADTLEEVQARGAVNCGISTGLVGFASQDANGEWQGFDVA
VCRAVAAAVFGDPTAVNFNPVTNQVRFEVLNSGEIDMLARNTTWTFSRDVDLKLEFTGIN
YYDGQGFMVPKALGVSSATELDGATVCIQKGTTTELNLADFFRANNISFEPVPISTASEA
QQQYLAGACDVYTTDASGLAATRASFESPDEHVVLPEIISKEPLGPLVRHGDNEWGDIVR
WTLNALIAAEELGVTSANVAELAAGTDNPEINRLLGTEGNLGEQLGLSADWAVNVIKAGG
NYGEIFETHIGENTPIGLARGLNAQWTEGGLLYAPPFR

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory