PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on 3608022 FitnessBrowser__Dino:3608022 (256 amino acids)

SeqID: 3608022 FitnessBrowser__Dino:3608022
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Cytoplasmic                   [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Cytoplasmic                   [matched 15597025: probable short-chain dehydrogenase[Pseudomonas aeruginosa PAO1]]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    Cytoplasmic            9.97
    Periplasmic            0.01
    CytoplasmicMembrane    0.01
    Extracellular          0.00
    OuterMembrane          0.00
  Final Prediction:
    Cytoplasmic            9.97

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>3608022 FitnessBrowser__Dino:3608022
MTETNTSRRLSGKTAIVTGAASGFGREIARRFVREGARVAIVDLNGEGAKAVADALQQNA
IAVTCDVSKGADVSRAVQETIDAFGRVDIAINNAGWSHRNQPALDVDFETFKRVYEVNVD
SIFHATHALVPHWRDIGGGVMINVGSTAGIRPRPGLSWYNSSKGAVNMMTKTLAVELAPD
RVRVCGLAPVMGATPLLETFMGMPDTPENRAKFLGTIPLGRLCEPEDMANAALYLASDEA
NFITGVILEVDGGRTV

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory