PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on 3608188 FitnessBrowser__Dino:3608188 (305 amino acids)

SeqID: 3608188 FitnessBrowser__Dino:3608188
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Cytoplasmic                   [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Cytoplasmic                   [matched 12231004: Homoserine O-succinyltransferase]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    Cytoplasmic            9.97
    Periplasmic            0.01
    CytoplasmicMembrane    0.01
    Extracellular          0.00
    OuterMembrane          0.00
  Final Prediction:
    Cytoplasmic            9.97

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>3608188 FitnessBrowser__Dino:3608188
MPIKIPETLPAFDVLSSEGVMVMGQGRADRQDIRPLQIGLLNLMPKKIQTETQFARLIGA
TPLQIDLTLIRMTEHQSKHTSAAHMEAFYRPFAEVRDRKFDGLIITGAPIEHLEFADVTY
WDELREVFAWTQTNVHATFGVCWGGMAMINHFHGVQKHILPAKAFGCFRHRNLAPASPYL
RGFSDDCVIPVSRWTEMKQSEIDAVPGLTTLLGSPEVGPCLVEDPGHRALYIFNHFEYDT
GTLKEEYDRDVENGTPINVPTNYYPDDDPARAPLNRWRSHAHLLYGNWLNEIYQTTEYDL
EKIGT

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory