PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on 3609154 FitnessBrowser__Dino:3609154 (308 amino acids)

SeqID: 3609154 FitnessBrowser__Dino:3609154
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Cytoplasmic                   [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Cytoplasmic                   [matched 15597667: conserved hypothetical protein[Pseudomonas aeruginosa PAO1]]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Non-Cytoplasmic               [Signal peptide detected]
  Localization Scores:
    Periplasmic            4.99
    CytoplasmicMembrane    4.90
    Extracellular          0.10
    OuterMembrane          0.00
    Cytoplasmic            0.00
  Final Prediction:
    Unknown (This protein may have multiple localization sites.)

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>3609154 FitnessBrowser__Dino:3609154
MKLATLAVGGNPMAVVLLSNGAALNYAACAWDVPGEAGDALRTGTLQALIDAGPDALDAL
REIVEAAENGSYRDARISLDNPFLAPLHTPRKNIFCVGRNYAEHIAEGERAQNAKIGITE
HPVYFTKPATAVVGHGGDVLIFPSVSEKIDYEVELAVVIGTTGRDIPKDRAFAHVFGYTI
LNDITARDVQRRHGGQYFKGKSLDGSCPIGPWIVTADEITDPQDLSISLSVNGELRQNGW
THDMIFDIPTLIASLSEGLTLEPGDIIATGTPSGVGYAMDPPQYLKPGDTVICDIANIGQ
LKNTVRVA