PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on 3609213 FitnessBrowser__Dino:3609213 (267 amino acids)

SeqID: 3609213 FitnessBrowser__Dino:3609213
  Analysis Report:
    CMSVM-            CytoplasmicMembrane           [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           CytoplasmicMembrane           [6 internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        CytoplasmicMembrane           [matched 462712: Cytoplasmic membrane integral membrane protein]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    CytoplasmicMembrane    10.00
    Cytoplasmic            0.00
    Periplasmic            0.00
    Extracellular          0.00
    OuterMembrane          0.00
  Final Prediction:
    CytoplasmicMembrane    10.00

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>3609213 FitnessBrowser__Dino:3609213
MGAMRSVYVLVTVCALLAIFGPMLAPHDPTAINIPNRLRPPGGEWLLGTDALGRDILSRL
LHGARWSLGLAFVVSLLGLIIGTTIGLIAAQGGRVADWIAMRATDTFLAFPELIAAVVIA
GVLGASTGSLIFALTVTGWMRYARVARGIGLSISNRGYVVQAQLAGLSPLAIARWHYLPS
LLPSLTVVWTGMLARAILGISTLGFLGFGVQPPMPEWGTMLLDARIHMRSTPLQMIWPGL
CVVVSVLAINLAGDALRDALAEQDAKT

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory