PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on 5208211 Shew_0723 ABC transporter-related protein (RefSeq) (240 amino acids)

SeqID: 5208211 Shew_0723 ABC transporter-related protein (RefSeq)
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Cytoplasmic                   [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        CytoplasmicMembrane           [matched 2829633: Cytoplasmic membrane integral membrane protein]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    CytoplasmicMembrane    7.88
    Cytoplasmic            2.11
    Periplasmic            0.00
    Extracellular          0.00
    OuterMembrane          0.00
  Final Prediction:
    CytoplasmicMembrane    7.88

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>5208211 Shew_0723 ABC transporter-related protein (RefSeq)
MLTMKNINKVFKTDLVETHALRDFNLEVKEGEFVAVTGPSGSGKTTFLNIAGLLEGFTNG
EYHLDDVNISNLSDNKAAAIRNEKIGFIFQGFNLIPDLNLAENVEVPLRYRGFNAKERQR
RVKAALEQVGLGARMKHLPSQLSGGQQQRVAIARALAGEPRFLLADEPTGNLDSLMARQV
MELLEEINKAGTTIIMVTHDPELARRAQRNIQIVDGQVCDFTLYQGGQSHLVDTAEKVAS