PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on 5208463 FitnessBrowser__PV4:5208463 (301 amino acids)

SeqID: 5208463 FitnessBrowser__PV4:5208463
  Analysis Report:
    CMSVM-            CytoplasmicMembrane           [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           CytoplasmicMembrane           [6 internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        CytoplasmicMembrane           [matched 400831: Cytoplasmic membrane integral membrane protein]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    CytoplasmicMembrane    10.00
    Cytoplasmic            0.00
    Periplasmic            0.00
    Extracellular          0.00
    OuterMembrane          0.00
  Final Prediction:
    CytoplasmicMembrane    10.00

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>5208463 FitnessBrowser__PV4:5208463
MKKSLKFRLPKGQCWTIGVPYFWLLMFFALPFAIVLKISLSTPAVAIPPYEALYQYADES
LQIMLNLGNYILIFEDHLYINAYLGSLKMACVTTIGCLLIGYPMAYAIARAPKQHQTVLI
LLVMLPSWTSFLIRVYAWMGILSNNGVINNLLMWLGVISEPIQMLNTNFAVYIGIIYTYL
PFMILPLYANLSQLDGSLLEAAADLGSRSLNTFWKVTLPLSKGGVIAGSMLVFIPVVGEF
VIPELLGGPDSLMIGKVLWQEFFNNRDWPVASSLAIVMLALLIIPITLFHRYQSRSMEKT
I

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory