PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on 5209393 Shew_1864 glucose-specific PTS system component (RefSeq) (169 amino acids)

SeqID: 5209393 Shew_1864 glucose-specific PTS system component (RefSeq)
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Cytoplasmic                   [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Cytoplasmic                   [matched 131515: Cytoplasmic protein]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    Cytoplasmic            9.97
    Periplasmic            0.01
    CytoplasmicMembrane    0.01
    Extracellular          0.00
    OuterMembrane          0.00
  Final Prediction:
    Cytoplasmic            9.97

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>5209393 Shew_1864 glucose-specific PTS system component (RefSeq)
MGFLSRIRRLISGQPPITGGIDVYAPVSGEIVAIEKVPDVVFAEKIVGDGIAIAPKGKQI
VAPVDGTIGKIFETNHAFSIESPQGLELFVHFGVGTVELRGNGFTRLAEEGQQVKAGDPI
LEFDLDYLKAHVESLLTPVVLANMEDIQGLDKRHGSIEAGKDVIFSVQL

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory