PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on 5209489 FitnessBrowser__PV4:5209489 (271 amino acids)

SeqID: 5209489 FitnessBrowser__PV4:5209489
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [1 internal helix found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Cytoplasmic                   [matched 15597025: probable short-chain dehydrogenase[Pseudomonas aeruginosa PAO1]]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    Cytoplasmic            9.26
    Periplasmic            0.48
    CytoplasmicMembrane    0.24
    OuterMembrane          0.01
    Extracellular          0.01
  Final Prediction:
    Cytoplasmic            9.26

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>5209489 FitnessBrowser__PV4:5209489
MFDYQGKNVFVVGGTSGINLGIAKAFAKAGANVAVASRRQEKVDAAVEALREINGQGKML
GVAFDVRDLEALKTGFKQIADAYGQLDVLVSGAAGNFPATAAELSENGFKSVMDIDLLGS
FQVLKQAYPLMRRPGGAIVQISAPQAYIAMPMQSHVSAAKAGVDMLTKSLALEWGIEGIR
VNSIVPGPISGTEGFSRLAPSDALQQAVAQSVPLKRNGSTDDIANAVMFIASEMASYITG
TVLPVDGGWSLGGASMAMSQLGKMAQQPKEN