PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on 5209832 FitnessBrowser__PV4:5209832 (351 amino acids)

SeqID: 5209832 FitnessBrowser__PV4:5209832
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Cytoplasmic                   [matched 15600647: oxidoreductase Rmd[Pseudomonas aeruginosa PAO1]]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    Cytoplasmic            9.26
    Periplasmic            0.48
    CytoplasmicMembrane    0.24
    OuterMembrane          0.01
    Extracellular          0.01
  Final Prediction:
    Cytoplasmic            9.26

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>5209832 FitnessBrowser__PV4:5209832
MSPGGKEVPEMKGEKMSILVTGGAGYIGSHACVELLSAGHQLVVLDNLSRAKFESLARVE
QITAAKLTFVEGDIRDERTLDALFSHYHIDAVMHFAGLKAVGESTRLPLEYYDNNVVGSM
RLLSAMTRHGVKTLVFSSSATVYGANPPLPIMEAAPRSSTNPYGQTKLVVEQMCAEWANA
KQDVSVILLRYFNPVGAHESGLIGEDPKGEPNNLLPYITQVAMGHRPYLSVFGSDYATTD
GTGVRDYIHVMDLVQGHLAALTRLHGVAGCHTFNLGSGQGYSVLEMVRAFEQASGKDIAL
HMAPRRPGDIAASYACPDKAARELDWRVARDLSQMMQDSWRWQCRNPRGYS

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory