PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on 6937060 FitnessBrowser__SB2B:6937060 (261 amino acids)

SeqID: 6937060 FitnessBrowser__SB2B:6937060
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Cytoplasmic                   [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        CytoplasmicMembrane           [matched 7404417: Oligopeptide transport ATP-binding protein oppF]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    CytoplasmicMembrane    7.88
    Cytoplasmic            2.11
    Periplasmic            0.00
    Extracellular          0.00
    OuterMembrane          0.00
  Final Prediction:
    CytoplasmicMembrane    7.88

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>6937060 FitnessBrowser__SB2B:6937060
MTTPLLKVTSLSKRYFTGYHRFKRQYNEALAPISFELGRGETLAIVGEAGSGKSTLARIL
VGAEQRSSGDIQFEGESLESRNLKQRCRLIRMIFQDPNTSLNPRLSIGELLEEPLRFNTG
MSAHERSVQVTETLRKVGLLPEHADFYPHMISEGQKQRVAVARALMLSPKVIIADEALTA
LDLSVRSQILNLLLHLQKEMGLSYIFVSHNLNLVRHVSDKIMVLHKGQLIEKGPVQKVFE
SPEHEYTARLIAEQTRQVRKR