PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on 6939275 FitnessBrowser__SB2B:6939275 (171 amino acids)

SeqID: 6939275 FitnessBrowser__SB2B:6939275
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Cytoplasmic                   [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Cytoplasmic                   [matched 15600232: shikimate kinase[Pseudomonas aeruginosa PAO1]]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    Cytoplasmic            9.97
    Periplasmic            0.01
    CytoplasmicMembrane    0.01
    Extracellular          0.00
    OuterMembrane          0.00
  Final Prediction:
    Cytoplasmic            9.97

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>6939275 FitnessBrowser__SB2B:6939275
MAEKRNIFLVGPMGAGKSTIGRHLAQMLHLEFHDSDQEIESRTGADIAWVFDVEGEEGFR
RREAQVIADLTEKQGIVLATGGGSVQSKDIRNYLSARGIVVYLETTIDKQVARTQRDKRR
PLLQVDDPRSVLETLAESRNPLYEEIADVIVKTDDQSAKVVANQIIEQLGF