PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on 7023157 Shewana3_0391 diaminopimelate epimerase (RefSeq) (275 amino acids)

SeqID: 7023157 Shewana3_0391 diaminopimelate epimerase (RefSeq)
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Cytoplasmic                   [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Cytoplasmic                   [matched 32172421: Cytoplasmic protein]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    Cytoplasmic            9.97
    Periplasmic            0.01
    CytoplasmicMembrane    0.01
    Extracellular          0.00
    OuterMembrane          0.00
  Final Prediction:
    Cytoplasmic            9.97

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>7023157 Shewana3_0391 diaminopimelate epimerase (RefSeq)
MIQFTKMHGLGNDFMVVDGVTQNVFFSPEQIRRLADRNFGIGFDQLLLVEPPYDPDLDFH
YRIFNADGGEVENCGNGARCFARFVRNKGLTNKNKIRVSTSAGKMTLRLERDGTVTVNMG
VPVLDPSQIPFKAKKAEKTYLLQTPQQTFLCGAASMGNPHCVLDVEDVANANVAEIGALL
TKHERFPRGVNVGFMQVVNSGHIKLRVYERGAAETLACGTGACAAVVVGQIQGKLDQQVR
VDLPGGTLTINWEGEGKPLWMTGPAQHVYDGQIQL