PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on 7023405 FitnessBrowser__ANA3:7023405 (251 amino acids)

SeqID: 7023405 FitnessBrowser__ANA3:7023405
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Cytoplasmic                   [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Cytoplasmic                   [matched 77416667: Cytoplasmic protein]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Non-Cytoplasmic               [Signal peptide detected]
  Localization Scores:
    Periplasmic            4.99
    CytoplasmicMembrane    4.90
    Extracellular          0.10
    OuterMembrane          0.00
    Cytoplasmic            0.00
  Final Prediction:
    Unknown (This protein may have multiple localization sites.)

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>7023405 FitnessBrowser__ANA3:7023405
MDKSKRQFLGKMASVSVGAALIPVVQVQAQPAQTATTSKRYGMVIDLRRCVGCQACTVAC
TFENLPPLGQFRTTVQQYEVSQQDSATPPAFLMLPRLCNHCENPPCIPICPTGATFQRPD
GIVVVNNEWCVGCGYCVQACPYDARFINHETNTADKCTFCAHRLEAGLLPACVETCVGEA
RVIGDLNDPHSHISQLLKANQADIKVLKPDANTAPRVFYIGMNSAFEDRINGQAPVRTLL
TDSGEEIHHGH