PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on 7024795 FitnessBrowser__ANA3:7024795 (363 amino acids)

SeqID: 7024795 FitnessBrowser__ANA3:7024795
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Cytoplasmic                   [matched 2506180: Phosphoserine aminotransferase]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    Cytoplasmic            9.26
    Periplasmic            0.48
    CytoplasmicMembrane    0.24
    Extracellular          0.01
    OuterMembrane          0.01
  Final Prediction:
    Cytoplasmic            9.26

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>7024795 FitnessBrowser__ANA3:7024795
MSAIYNFCAGPAMLPAAVMKKAQQELLDWNGLGVSVMEVSHRGKEFIALTKQAEADLREL
MHIPQNYHVLFMHGGGRGQFSAVVNNFLGNQGRALYLVSGQWSSAALAEAQKLAGDTQID
SLNIVEKHNGLNAVVLPELHKIDADYRYVHYCPNETVDGIEIFDELDSPWPIVADLSSTI
MSREIDVSRYGLIYAGAQKNIGPSGLSIVIVRDDMLKLPSLTQSSIMDYRLAVEHDSMFN
TPPTFAWYLAAEVFAWLKSLGGVASIAKINQQKAQMLYACIDANPFYKNGVVAANRSQMN
VTFQLADESLDGAFLKEAEAAGLVALKGHRIVGGMRASLYNAMPLEGVAALVSFMNEFAA
KHS

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory