PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on 8499289 FitnessBrowser__Miya:8499289 (259 amino acids)

SeqID: 8499289 FitnessBrowser__Miya:8499289
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Cytoplasmic                   [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Cytoplasmic                   [matched 77416667: Cytoplasmic protein]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Non-Cytoplasmic               [Signal peptide detected]
  Localization Scores:
    Periplasmic            4.99
    CytoplasmicMembrane    4.90
    Extracellular          0.10
    OuterMembrane          0.00
    Cytoplasmic            0.00
  Final Prediction:
    Unknown (This protein may have multiple localization sites.)

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>8499289 FitnessBrowser__Miya:8499289
MSTTRRQFLKIAGLAAFGLGTSSALDAADAVAKDMPGAKYDVGGKHLAAKRWAMVIDTRK
LESREDFERIIHACHSVHNVPSIPSKQEIKWIWTDKYDRVFTDDMSQHLSPAVREKDYLL
LCNHCENPPCVRVCPTKATFKRADGIVVMDYHRCIGCRFCMAGCPYGARSFNFGDPRPYL
KDVNPAFPTRMRGVVEKCTFCSERLEVGLLPACVEASNGAILFGDLDDPNSPVRKALAEN
FSIRRKPSIGTQPGVYYIV