Running PSORTb v3.0 on 8499289 FitnessBrowser__Miya:8499289 (259 amino acids)
SeqID: 8499289 FitnessBrowser__Miya:8499289 Analysis Report: CMSVM- Unknown [No details] CytoSVM- Cytoplasmic [No details] ECSVM- Unknown [No details] ModHMM- Unknown [No internal helices found] Motif- Unknown [No motifs found] OMPMotif- Unknown [No motifs found] OMSVM- Unknown [No details] PPSVM- Unknown [No details] Profile- Unknown [No matches to profiles found] SCL-BLAST- Cytoplasmic [matched 77416667: Cytoplasmic protein] SCL-BLASTe- Unknown [No matches against database] Signal- Non-Cytoplasmic [Signal peptide detected] Localization Scores: Periplasmic 4.99 CytoplasmicMembrane 4.90 Extracellular 0.10 OuterMembrane 0.00 Cytoplasmic 0.00 Final Prediction: Unknown (This protein may have multiple localization sites.) -------------------------------------------------------------------------------
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in the ENIGMA genome browser
>8499289 FitnessBrowser__Miya:8499289 MSTTRRQFLKIAGLAAFGLGTSSALDAADAVAKDMPGAKYDVGGKHLAAKRWAMVIDTRK LESREDFERIIHACHSVHNVPSIPSKQEIKWIWTDKYDRVFTDDMSQHLSPAVREKDYLL LCNHCENPPCVRVCPTKATFKRADGIVVMDYHRCIGCRFCMAGCPYGARSFNFGDPRPYL KDVNPAFPTRMRGVVEKCTFCSERLEVGLLPACVEASNGAILFGDLDDPNSPVRKALAEN FSIRRKPSIGTQPGVYYIV
Lawrence Berkeley National Laboratory