PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on 8500263 DvMF_1020 oligopeptide/dipeptide ABC transporter, ATPase subunit (RefSeq) (358 amino acids)

SeqID: 8500263 DvMF_1020 oligopeptide/dipeptide ABC transporter, ATPase subunit (RefSeq)
  Analysis Report:
    CMSVM-            CytoplasmicMembrane           [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        CytoplasmicMembrane           [matched 6174923: Oligopeptide transport ATP-binding protein oppD]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    CytoplasmicMembrane    10.00
    Cytoplasmic            0.00
    Periplasmic            0.00
    OuterMembrane          0.00
    Extracellular          0.00
  Final Prediction:
    CytoplasmicMembrane    10.00

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>8500263 DvMF_1020 oligopeptide/dipeptide ABC transporter, ATPase subunit (RefSeq)
MTDDNRTPRTVTDEPRLLDVRDLSVEFPGRPEADGTPGAPLRAVAGISFSIAPGGTLCLV
GESGCGKSMTALALLRLVPEPGRVASGSVRLEGRELLTLPEPEMRGVRGRSISMIFQEPM
TSLNPVFRVGEQIAEGVRLHLGLSRSDAAARAVDLLRQVGIPSPELRARDFPHQMSGGMR
QRVMIAMALACDPRLLIADEPTTALDVTIQRQILRLMRDLAAHRGASVLLITHDLGVVAE
TADHVAVMYAGRIMEHASVGDFFARPLHPYAQGLMRSVPQAVSGPRAERLSAIPGTVPPL
WALPSGCTFRDRCPHAFARCAEQEPPLLAMPPQALAATPTDNAAQAHGVRCWLHAPKK