PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on 8500660 FitnessBrowser__Miya:8500660 (353 amino acids)

SeqID: 8500660 FitnessBrowser__Miya:8500660
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Cytoplasmic                   [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Cytoplasmic                   [matched 15596878: chorismate synthase[Pseudomonas aeruginosa PAO1]]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    Cytoplasmic            9.97
    Periplasmic            0.01
    CytoplasmicMembrane    0.01
    Extracellular          0.00
    OuterMembrane          0.00
  Final Prediction:
    Cytoplasmic            9.97

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>8500660 FitnessBrowser__Miya:8500660
MSGNTFGRIFRLTTYGESHGPGLGGVVDGCPAGVPLDESVIQRELDLRRPGSASAGLAGT
ARKEPDTVRLLSGVFEGVTTGTPIGFHIANEDQRSRDYGDLAKLYRPGHADITYDAKYGL
RDFRGGGRASGRETVSRVAGGAVALALLAMHDIEVRAYTVEIGGVPADVVDPAGAQGRLF
FSPDPDVVPAWESLVHDVRAEGDTLGGIVQVEATGVPAGLGEPVFDKLDALLAHAMMSVG
AVKAVEVGAGLEAARLRGSENNDPIIPGGFHTNHAGGILGGISNGQPIVVRATVKPIPSI
AQEQITIDTNGRPAPLRVGGRHDICAIPRVVPVLKAMAALVLADSLLLQRRMG

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory