PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on 8500830 FitnessBrowser__Miya:8500830 (249 amino acids)

SeqID: 8500830 FitnessBrowser__Miya:8500830
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Cytoplasmic                   [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [1 internal helix found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Periplasmic                   [matched 84028140: Cystine-binding periplasmic protein precursor]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Non-Cytoplasmic               [Signal peptide detected]
  Localization Scores:
    Periplasmic            9.76
    CytoplasmicMembrane    0.12
    Extracellular          0.11
    OuterMembrane          0.00
    Cytoplasmic            0.00
  Final Prediction:
    Periplasmic            9.76

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>8500830 FitnessBrowser__Miya:8500830
MFRMTTLVAALALVLALGGVAFAEKTYINGIDANYPPFAYVDKSGKPAGFDVESMDWIAK
KMGFKVTHQPMDWDGIIPNLLAKKIDMVCSGMSITEERRQKVNFSNPYWNVKQVFIAKKG
STLNTDQILKGKVKLGVQRGTSEAEALQKDKEAKGYGYDLRFYDSAPLAIEDVLNGRIDA
ATMDNLPADDAAAKGKAIQVVGVYGDSEDFGVATRKEDAELLKMINDGYKLLMADPYWEQ
LKQKHLATK

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory