PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on 8500846 FitnessBrowser__Miya:8500846 (234 amino acids)

SeqID: 8500846 FitnessBrowser__Miya:8500846
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Cytoplasmic                   [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Cytoplasmic, CytoplasmicMembrane[matched 71164840: Cytoplasmic membrane associated cytoplasmic protein]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    Cytoplasmic            9.12
    CytoplasmicMembrane    0.88
    Periplasmic            0.00
    Extracellular          0.00
    OuterMembrane          0.00
  Final Prediction:
    Cytoplasmic (This protein may have multiple localization sites.) 9.12

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>8500846 FitnessBrowser__Miya:8500846
MLDVRNINVAYGDVQVIWDVSFRVGQGEIVAMIGANGAGKSTIMRTVSGVLRPGKGQILL
AGEAIHNVEPYTLIEKGLAHVPEARRLFPEMSVEENLDMGSLRGRARKERARTKDRVFSI
FPRLAERRRQASGTLSGGEQQMLAIGRGLMALPRLIMFDEPSLGLAPILVQDIFGVIRTV
RDEGMTVLIVEQNVRQTLALCDRAYVLENGRITQEGAGADLLRDPHVKAAYLGV

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory