PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on 8501089 DvMF_1825 oligopeptide/dipeptide ABC transporter, ATPase subunit (RefSeq) (339 amino acids)

SeqID: 8501089 DvMF_1825 oligopeptide/dipeptide ABC transporter, ATPase subunit (RefSeq)
  Analysis Report:
    CMSVM-            CytoplasmicMembrane           [No details]
    CytoSVM-          Cytoplasmic                   [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        CytoplasmicMembrane           [matched 1168476: Oligopeptide transport ATP-binding protein appF]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    CytoplasmicMembrane    9.99
    Cytoplasmic            0.01
    Periplasmic            0.00
    Extracellular          0.00
    OuterMembrane          0.00
  Final Prediction:
    CytoplasmicMembrane    9.99

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>8501089 DvMF_1825 oligopeptide/dipeptide ABC transporter, ATPase subunit (RefSeq)
MTNQITALLSLRNVVKHFDISGGLLDQLRISGGRITRKRTVVHAVNDVSFDILPGETLSV
VGESGCGKSTLARTVIGLYRATGGEILYRGERIDNLSDNGMLPYRTRMQMVFQDPYASLN
PRMKVREILEEPVRFHNPGISDADVRARVADVMEQVGVNPLWGVRYPHEFSGGQRQRISI
ARALVVDPEFIVADEPISALDVSIQAQVLNLMMDMQEKRNLTYLFISHDLSVVEHISTRV
AVMYLGSLCELASAEDLFGNPRHPYTRALLSAIPRIGGKAAGHIKLSGDVPTPINLPTGC
VFHGRCQHANARCMQEVPKARQLEGGAQVACHGVEEGRI

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory