PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on 8501181 FitnessBrowser__Miya:8501181 (98 amino acids)

SeqID: 8501181 FitnessBrowser__Miya:8501181
  Analysis Report:
    CMSVM-            CytoplasmicMembrane           [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           CytoplasmicMembrane           [3 internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Unknown                       [No matches against database]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    CytoplasmicMembrane    10.00
    Periplasmic            0.00
    Extracellular          0.00
    OuterMembrane          0.00
    Cytoplasmic            0.00
  Final Prediction:
    CytoplasmicMembrane    10.00

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>8501181 FitnessBrowser__Miya:8501181
MPAPTADSAALSTLFEIIGYAAGLLTSLAYLPQVVRIARTRSADDISLPTFRLLAVGVAL
WLVYGIGIGSWPVMAANAVGLALILAVIWLKLRYSRQL

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory