PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on 8501223 FitnessBrowser__Miya:8501223 (358 amino acids)

SeqID: 8501223 FitnessBrowser__Miya:8501223
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [1 internal helix found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Periplasmic                   [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Periplasmic                   [matched 130691: Periplasmic protein]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Non-Cytoplasmic               [Signal peptide detected]
  Localization Scores:
    Periplasmic            10.00
    Extracellular          0.00
    CytoplasmicMembrane    0.00
    OuterMembrane          0.00
    Cytoplasmic            0.00
  Final Prediction:
    Periplasmic            10.00

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>8501223 FitnessBrowser__Miya:8501223
MRTKLHAARAALVMVGLALAVLAATLFAGPAVAAEEKVLHVYNWSEYVPQSVLDRFTKET
GIKVVYTTYESNEAMYAKVKLLKGVGYDVVVPSTYFISMMRDDGLLARIDKSKLKNFKNL
SPKVLNQPFDPGNEYSVPYMWGSAGLMVNRKVVDPASITSWNDLNRPEFAGKVILSDDQR
DSMGVALKALGYSVNSTNEAEIKAAYEWLKKLLPAVRVFDVTASKQAFISEEVAAGLIWN
GDAYIAASENENLVYVYPREGVPLWVDSLAIPVGAKHKDNAHKFIDFLLRPDVAKECVEE
YNYSTPNVGAQKILSPELAKSRITSPSDADLKNAEFTNSVGNALEIYEKYWEMLKTGS

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory