PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on AO353_06170 FitnessBrowser__pseudo3_N2E3:AO353_06170 (146 amino acids)

SeqID: AO353_06170 FitnessBrowser__pseudo3_N2E3:AO353_06170
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [1 internal helix found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Cytoplasmic                   [matched 15595442: 3-dehydroquinate dehydratase[Pseudomonas aeruginosa PAO1]]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    Cytoplasmic            9.26
    Periplasmic            0.48
    CytoplasmicMembrane    0.24
    OuterMembrane          0.01
    Extracellular          0.01
  Final Prediction:
    Cytoplasmic            9.26

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>AO353_06170 FitnessBrowser__pseudo3_N2E3:AO353_06170
MSPIVLVLNGPNLNLLGSREPATYGHETLADISALCGRAGEEFGLAVEFRQTNHEGELLD
WIHSARGRCAGIVINPAAWTHTSVAIRDALIASELPVIEVHLSNVHAREPFRHHSFVSAI
ATAVLCGFGSHGYRLALEHFSQRLKG