PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on AO353_12330 FitnessBrowser__pseudo3_N2E3:AO353_12330 (244 amino acids)

SeqID: AO353_12330 FitnessBrowser__pseudo3_N2E3:AO353_12330
  Analysis Report:
    CMSVM-            CytoplasmicMembrane           [No details]
    CytoSVM-          Cytoplasmic                   [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        CytoplasmicMembrane           [matched 121397: Glutamine transport ATP-binding protein glnQ]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    CytoplasmicMembrane    9.99
    Cytoplasmic            0.01
    Periplasmic            0.00
    Extracellular          0.00
    OuterMembrane          0.00
  Final Prediction:
    CytoplasmicMembrane    9.99

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>AO353_12330 FitnessBrowser__pseudo3_N2E3:AO353_12330
VIEVRDLVKVFDTRGQVVRAVDNVTTRVAKGEVLVVIGPSGSGKSTFLRCLNGLEAFDSG
SVSIDGLQLADPKTDVNAYRREVGMVFQHFNLFPHMTVLENLCLAQKVVRKRGKQEREAK
ALALLEKVGIAQKAHEFPSRLSGGQQQRVAIARALAMEPKVMLFDEPTSALDPEMVGEVL
DVMKTLAVEGMTMVCVTHEMGFAREVADRVLFFDHGKLLEDASPAEFFDAPKDPRAQAFL
RQVL

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory