PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on AO353_18585 FitnessBrowser__pseudo3_N2E3:AO353_18585 (263 amino acids)

SeqID: AO353_18585 FitnessBrowser__pseudo3_N2E3:AO353_18585
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Cytoplasmic                   [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Cytoplasmic                   [matched 15596069: phenylalanine-4-hydroxylase[Pseudomonas aeruginosa PAO1]]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    Cytoplasmic            9.97
    Periplasmic            0.01
    CytoplasmicMembrane    0.01
    Extracellular          0.00
    OuterMembrane          0.00
  Final Prediction:
    Cytoplasmic            9.97

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>AO353_18585 FitnessBrowser__pseudo3_N2E3:AO353_18585
MKQTQYVAREPDAQGFIHYTAEEHAVWNTLITRQLKVLEGRACQEYMDGIEKLGLPHDRI
PQLDEINKVLGETTGWQVARVPALIPFQTFFELLASKQFPVATFIRTREELDYLQEPDIF
HEIFGHCPLLTNPWFAEFTHTYGKLGLQASKEERVYLARLYWMTIEFGLVDTPQGKRIYG
GGILSSPKETVYSLSGEPEHQAFDPLEAMRTPYRIDILQPLYFVLPNLKRLFDLAHEDIM
GMVHQGMQLGLHAPKFPPKPKAA