PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on AO353_25420 AO353_25420 spermidine/putrescine ABC transporter ATP-binding protein (372 amino acids)

SeqID: AO353_25420 AO353_25420 spermidine/putrescine ABC transporter ATP-binding protein
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        CytoplasmicMembrane           [matched 20141512: Maltose/maltodextrin import ATP-binding protein malK]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    CytoplasmicMembrane    9.82
    Cytoplasmic            0.15
    OuterMembrane          0.01
    Periplasmic            0.01
    Extracellular          0.01
  Final Prediction:
    CytoplasmicMembrane    9.82

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>AO353_25420 AO353_25420 spermidine/putrescine ABC transporter ATP-binding protein
MNALHSLQTLAVSIRAVRKVYGDPHSGPVALKSIDLDIRDNEFFTLLGPSGCGKTTLLRM
IAGFEFPTQGEILLYGENIADRPPYQRPVNTVFQHYALFPHMTIAENLAFGLESHPMGKV
LSKAQIAERVREMLALVQMERFATRRPTQLSGGQQQRVALARALAPHPKVLLLDEPLSAL
DLKLRQAMREELKAIQAKTGITFIFVTHDQEEALTMSDRIAVLSEGEVQQVGRPEDIYER
PRNRFVADFIGETNFIEGTVTHVEAGLAWFAGPAGHPLPAQPCSDVNVGATVALSVRPER
LHLLPANTDGALPCRIDAQIYLGTDLQYQVSLNDGSRLTVRTPNSVDQSLRFAVGSQAGL
LFDRGSASVLLD

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory