PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on AO356_07555 FitnessBrowser__pseudo5_N2C3_1:AO356_07555 (274 amino acids)

SeqID: AO356_07555 FitnessBrowser__pseudo5_N2C3_1:AO356_07555
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Cytoplasmic                   [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        CytoplasmicMembrane           [matched 71159382: Anaerobic glycerol-3-phosphate dehydrogenase subunit C]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    CytoplasmicMembrane    7.88
    Cytoplasmic            2.11
    Periplasmic            0.00
    Extracellular          0.00
    OuterMembrane          0.00
  Final Prediction:
    CytoplasmicMembrane    7.88

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>AO356_07555 FitnessBrowser__pseudo5_N2C3_1:AO356_07555
MSELFYNAVPNATRVAPPLPEPRQYPSEKPRRVYLFGTCVVDLFYPEAGMDAIHLLEREG
IRVDYPQGQSCCGQPAYTSGYTEQARTVARAQLALFAEDYPVVVPSGSCAGMLREHYADL
FKDEPETLKQVQALAARTYELAEFLLLVCKVQLNDSGEPVKVALHTSCSARREMNTHLHG
RALLAQLRNVERVEHSHESECCGFGGTFSVRMPDISGAMVADKTRALKESGAHQVLSADC
GCLMNINGALEKQQEALRGKHLASFLWQRTGGAA