PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on AO356_08500 AO356_08500 amino acid ABC transporter substrate-binding protein (378 amino acids)

SeqID: AO356_08500 AO356_08500 amino acid ABC transporter substrate-binding protein
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [2 internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Periplasmic                   [matched 15600106: probable binding protein component of ABC transporter[Pseudomonas aeruginosa PAO1]]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Non-Cytoplasmic               [Signal peptide detected]
  Localization Scores:
    Periplasmic            9.76
    Extracellular          0.11
    CytoplasmicMembrane    0.06
    OuterMembrane          0.06
    Cytoplasmic            0.00
  Final Prediction:
    Periplasmic            9.76

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>AO356_08500 AO356_08500 amino acid ABC transporter substrate-binding protein
MSQTFYKKGFLALAVAAALGVSAFAQADVKFGVAGPMTGANAAFGEQYMKGAQAAADAIN
KAGGVNGEKIVLVAGDDACEPKQAVAVANRLVDQDKVIGVVGHFCSSNTIPASEVYDEAG
IIAITPGSTNPQVTERGLSAMFRMCGRDDQQGIVAGDYIVDVLKGKKVAVLHDKDTYGQG
LADATKAQLAKRGVKEVLYEGLTRGEKDFSAVVTKIRSVGADVVYFGGLHPEAGPLVRQL
REQGLKDVKFMSDDGIVTDELVTTAGGAQYVDGVYMTFGADPRLLPDSKAVVEEFRKNGT
EPEGYTLYAYASVQALAAGFNGAKSNKGEDAAKWLKANPVQTVMGKKEWDTKGDLKVSDY
VVYQWDKDGKYHQLEKQK

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory