PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on AO356_17350 FitnessBrowser__pseudo5_N2C3_1:AO356_17350 (258 amino acids)

SeqID: AO356_17350 FitnessBrowser__pseudo5_N2C3_1:AO356_17350
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Periplasmic                   [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Periplasmic                   [matched 15599060: probable amino acid binding protein[Pseudomonas aeruginosa PAO1]]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Non-Cytoplasmic               [Signal peptide detected]
  Localization Scores:
    Periplasmic            10.00
    Extracellular          0.00
    CytoplasmicMembrane    0.00
    OuterMembrane          0.00
    Cytoplasmic            0.00
  Final Prediction:
    Periplasmic            10.00

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>AO356_17350 FitnessBrowser__pseudo5_N2C3_1:AO356_17350
MSKLPLITGLALSLLASSSLFAAEKTLRIGIEAAYPPFASKTSEGKIEGFDYDIGNALCA
QMQVKCQWIEGEFDGLIPSLKVKKIDLALSSMTITEERKKSVDFTHKYYFTSSRLVMKEG
AVVDDQYASLKGKTVGVQRATTTDRYATEVLEPKGVTVKRYSNNEEIYMDLASGRLDAIF
ADTIPLEDFLSMPRGKGYAFVGPELKDPKYVGEGAGIAVRKGNTQLVADLNKAIDGIRAN
GKYQEIQAKYFKSDIYGD