PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on AO356_28625 AO356_28625 ectoine/hydroxyectoine ABC transporter ATP-binding protein EhuA (259 amino acids)

SeqID: AO356_28625 AO356_28625 ectoine/hydroxyectoine ABC transporter ATP-binding protein EhuA
  Analysis Report:
    CMSVM-            CytoplasmicMembrane           [No details]
    CytoSVM-          Cytoplasmic                   [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        CytoplasmicMembrane           [matched 2506103: Histidine transport ATP-binding protein hisP]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    CytoplasmicMembrane    9.99
    Cytoplasmic            0.01
    Periplasmic            0.00
    Extracellular          0.00
    OuterMembrane          0.00
  Final Prediction:
    CytoplasmicMembrane    9.99

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>AO356_28625 AO356_28625 ectoine/hydroxyectoine ABC transporter ATP-binding protein EhuA
MAHKSEELIIEALDVHKSFGELQILKGISLQVRRGEVVVLIGASGSGKTTFIRCINLLED
IQGGRIRVNGRAMGYRERADGSLVRESERNIARQRRDIGMVFQRFNLFPHMTALENIIEA
PIQVLGVSRVAALEQARGLLERVGLADKADHYPSMLSGGQQQRVAIARALAMKPQAMLFD
EPTSALDPETVGEVLQVMKELAEEGMTMVVVTHEMGFAREVADRVVVLDQGELIEQGPPE
QIFCHPIHPRTRAFLSRVL

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory