PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on AO356_29645 FitnessBrowser__pseudo5_N2C3_1:AO356_29645 (248 amino acids)

SeqID: AO356_29645 FitnessBrowser__pseudo5_N2C3_1:AO356_29645
  Analysis Report:
    CMSVM-            CytoplasmicMembrane           [No details]
    CytoSVM-          Cytoplasmic                   [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        CytoplasmicMembrane           [matched 121397: Glutamine transport ATP-binding protein glnQ]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    CytoplasmicMembrane    9.99
    Cytoplasmic            0.01
    Periplasmic            0.00
    Extracellular          0.00
    OuterMembrane          0.00
  Final Prediction:
    CytoplasmicMembrane    9.99

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>AO356_29645 FitnessBrowser__pseudo5_N2C3_1:AO356_29645
MIEIKGIHKRYGSVPVLEGIDLQVKSGEVVCLIGPSGSGKSTLLRCINGLESYDQGEVLV
GDERVDRNARNIHDIRTRVAMVFQRFNLFPHRTALENVMEGPIYVKKENPQAARKNAEAL
MEKVGLSHRMNAYPDELSGGQQQRVAIARALAMNPQAILFDEPTSALDPELVGEVLAVMR
NLANEGMTMIVVTHEMAFARDVADKVCFLHSGKIVESGPAGEVLSTPTHPRTQDFLRRLL
NHSGEVPA