PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on AZOBR_RS27130 AZOBR_RS27130 polyamine ABC transporter substrate-binding protein (259 amino acids)

SeqID: AZOBR_RS27130 AZOBR_RS27130 polyamine ABC transporter substrate-binding protein
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [1 internal helix found]
    Motif-            Periplasmic                   [matched PS01039: SBP_BACTERIAL_3 Pattern - Periplasmic]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Periplasmic                   [matched 6685721: Octopine-binding periplasmic protein precursor]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Non-Cytoplasmic               [Signal peptide detected]
  Localization Scores:
    Periplasmic            10.00
    Extracellular          0.00
    CytoplasmicMembrane    0.00
    OuterMembrane          0.00
    Cytoplasmic            0.00
  Final Prediction:
    Periplasmic            10.00

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>AZOBR_RS27130 AZOBR_RS27130 polyamine ABC transporter substrate-binding protein
MKRLALGLAMGLCALAAAVPTASRADGPPLRIATEGAYPPFNMTSPDGTLGGLEVELANA
LCERIKRRCTLVAQDWDGIIPGLLSRRYDAIMATMNITPERAKAIAFSAPYMVVPAYFVA
ATGGGIDGTEATLAGKSVGAQTSTTHYRYVEKHFGKTVSLKNYDTASNLLADLKSGRIDA
AITTGATASDWVKADASKSLQLVGKPLVDAEVFGPGVGVGLRKEDADLKAAFDAAIASVV
QDGTLARIAAKYVDFTVTP

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory