PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on Ac3H11_161 TRAP-type transport system, periplasmic component, predicted N-acetylneuraminate-binding protein (323 amino acids)

SeqID: Ac3H11_161 TRAP-type transport system, periplasmic component, predicted N-acetylneuraminate-binding protein
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [1 internal helix found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Periplasmic                   [matched 586718: 2,3-diketo-L-gulonate-binding periplasmic protein yiaO precursor]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Non-Cytoplasmic               [Signal peptide detected]
  Localization Scores:
    Periplasmic            9.76
    Extracellular          0.11
    CytoplasmicMembrane    0.06
    OuterMembrane          0.06
    Cytoplasmic            0.00
  Final Prediction:
    Periplasmic            9.76

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>Ac3H11_161 TRAP-type transport system, periplasmic component, predicted N-acetylneuraminate-binding protein
MQLTRLVVGLSLALGFVATAAAQTTMRISISTAQNSHQGIAIDTFAKEVEKRTSGRYKVQ
TFYNGALGGERESIEAVQLGTQELAFSSTGPIPNFVPETKILDVPFLFRDKAHARAVLDG
PIGQEMLTKFDSKGFKALAWAENGFRHMTNSKRSVNTPEDLKGLKMRTMENPVHIAAYKG
FGIITTPMAFPEVFTALQQGTVDGQENPLPVIISAKFDQVQKHLTLTGHVYSPAIFVMNK
GSFDKLSAADKQAFIDAAKEGTKANRARVDEDDAKGVADLRAKGMTVVDNPDKSKFVAAL
APVNAEFEKQFGKATLDKIRDVK