PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on Ac3H11_3037 FitnessBrowser__acidovorax_3H11:Ac3H11_3037 (268 amino acids)

SeqID: Ac3H11_3037 FitnessBrowser__acidovorax_3H11:Ac3H11_3037
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Cytoplasmic                   [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        CytoplasmicMembrane           [matched 7404442: Ribose import ATP-binding protein rbsA]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    CytoplasmicMembrane    7.88
    Cytoplasmic            2.11
    Periplasmic            0.00
    Extracellular          0.00
    OuterMembrane          0.00
  Final Prediction:
    CytoplasmicMembrane    7.88

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>Ac3H11_3037 FitnessBrowser__acidovorax_3H11:Ac3H11_3037
MTTSTQTTNVPLVMQAKGLVKRYGQVTALDGADFELRAGEILAVIGDNGAGKSSLIKALS
GATVPDEGEILLDGQRIQFKSPIEARRAGIETVYQDLAVAPAMTIAENLFLGRELRRPGL
LGTALRMLDKKKMLEESVARMAELKVGIRSMTQAVETLSGGQRQCVAVARAAAFARHVVI
MDEPTAALGVKEGNMVLELIRRVRDKGLPVILISHNMPHVFEIADRIHIARLGKRAAVVN
PKKISMSDTVAVMTGAMAASDLPAECLA

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory