PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on Ac3H11_3725 FitnessBrowser__acidovorax_3H11:Ac3H11_3725 (280 amino acids)

SeqID: Ac3H11_3725 FitnessBrowser__acidovorax_3H11:Ac3H11_3725
  Analysis Report:
    CMSVM-            CytoplasmicMembrane           [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        CytoplasmicMembrane           [matched 118129: Sulfate/thiosulfate import ATP-binding protein cysA]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    CytoplasmicMembrane    10.00
    Cytoplasmic            0.00
    Periplasmic            0.00
    OuterMembrane          0.00
    Extracellular          0.00
  Final Prediction:
    CytoplasmicMembrane    10.00

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>Ac3H11_3725 FitnessBrowser__acidovorax_3H11:Ac3H11_3725
MTSPAESPPLAHAQAPLPHSTPAVEVLSAEKTYPNGTQALLPVDLTIEEGEFVTLLGPSG
CGKSTLLKMVAGLLEPTDGRLHLWRKPVAQLDESGKKMAFVFQSPTLMPWASVQTNVRLP
LDLAGVPRAEADARVTEALALVGLSKFANALPRALSGGMQMRVSIARGLVTQPDLLLMDE
PFGALDEITRHKLDADLLDLWRKKKLTVIFVTHSIHEAVFLSSRVVMMAARPGRVVEEFR
IDAPYPRTADFMVSPEFSRYAKLLQDSLLRASVDTEETVA