PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on Ac3H11_4731 FitnessBrowser__acidovorax_3H11:Ac3H11_4731 (220 amino acids)

SeqID: Ac3H11_4731 FitnessBrowser__acidovorax_3H11:Ac3H11_4731
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Cytoplasmic                   [matched 45593460: Imidazole glycerol phosphate synthase subunit hisH]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    Cytoplasmic            9.26
    Periplasmic            0.48
    CytoplasmicMembrane    0.24
    OuterMembrane          0.01
    Extracellular          0.01
  Final Prediction:
    Cytoplasmic            9.26

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>Ac3H11_4731 FitnessBrowser__acidovorax_3H11:Ac3H11_4731
MEAKTVVVVDYGMGNLRSVSQAVQAAAQGTGWTVVVTQRPEDVRAAARVVLPGQGAMPDC
MRELRESGLQESVLEAAATKPLFGVCVGMQMLLDHSAEGDTPGLSLIPGEVRKFDLAGRT
QPDGSRFKVPQMGWNQVRQMEHAGAVHPVWAGVPDNSYFYFVHSFYAVPQNPAHCAGQAD
YGGVFAAAIARDNIFATQFHPEKSAEHGLALYRNFLHWNP