Running PSORTb v3.0 on Ac3H11_990 FitnessBrowser__acidovorax_3H11:Ac3H11_990 (244 amino acids)
SeqID: Ac3H11_990 FitnessBrowser__acidovorax_3H11:Ac3H11_990 Analysis Report: CMSVM- Unknown [No details] CytoSVM- Unknown [No details] ECSVM- Unknown [No details] ModHMM- Unknown [No internal helices found] Motif- Unknown [No motifs found] OMPMotif- Unknown [No motifs found] OMSVM- Unknown [No details] PPSVM- Unknown [No details] Profile- Unknown [No matches to profiles found] SCL-BLAST- CytoplasmicMembrane [matched 119898: Iron(III) dicitrate transport ATP-binding protein fecE] SCL-BLASTe- Unknown [No matches against database] Signal- Unknown [No signal peptide detected] Localization Scores: CytoplasmicMembrane 9.82 Cytoplasmic 0.15 OuterMembrane 0.01 Periplasmic 0.01 Extracellular 0.01 Final Prediction: CytoplasmicMembrane 9.82 -------------------------------------------------------------------------------
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in the ENIGMA genome browser
>Ac3H11_990 FitnessBrowser__acidovorax_3H11:Ac3H11_990 LQGIDLQLPAGRWTSIVGPNGAGKSTLLKVLAGLLPRAAVQGEVQLLGRPLAQIPARERA RQLAWLGQNEGSADDLTSYDVAMLGRLPHQAWLAPPGAADHAAVEQALRTTQAWDWRHRP LSQLSGGERQRVLLARALAVQAQVLLMDEPLANLDPPHQTDWLHTMRALVEAGGTVVSVL HEVSLALQADDMVVMANGRVLHQGACGAPATHAALEEVFDHRIQVRHLDGLWMALPSLQR QNKQ
Lawrence Berkeley National Laboratory