PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on BPHYT_RS10275 FitnessBrowser__BFirm:BPHYT_RS10275 (262 amino acids)

SeqID: BPHYT_RS10275 FitnessBrowser__BFirm:BPHYT_RS10275
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [1 internal helix found]
    Motif-            Periplasmic                   [matched PS01039: SBP_BACTERIAL_3 Pattern - Periplasmic]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Periplasmic                   [matched 15598119: periplasmic histidine-binding protein HisJ[Pseudomonas aeruginosa PAO1]]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Non-Cytoplasmic               [Signal peptide detected]
  Localization Scores:
    Periplasmic            10.00
    Extracellular          0.00
    CytoplasmicMembrane    0.00
    OuterMembrane          0.00
    Cytoplasmic            0.00
  Final Prediction:
    Periplasmic            10.00

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>BPHYT_RS10275 FitnessBrowser__BFirm:BPHYT_RS10275
MLQKLSLSVFVAAALLGSVGTVSAETQNTLRFGIEAAYPPFESKSPTGQLEGFDVDVGNA
VCAKMGVKCEWVENAFDGLIPALQARKFDAINSAMNITDKRKQTIAFTRPIYVVPIVMVA
KRSSGLLPDVKSLQGKRVGVLQASSQEDFLKRHWANAGVSIVSYADQDQVYADLVAGRLD
AAVQEAQTVQDGFLNKPAGHDYAIAGQPLSDPATLGEGTGFGLRKGDRALAGKIDAALDA
LKKDGTLSALSQKYFKRDIIAK

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory