PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on BPHYT_RS12455 FitnessBrowser__BFirm:BPHYT_RS12455 (278 amino acids)

SeqID: BPHYT_RS12455 FitnessBrowser__BFirm:BPHYT_RS12455
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Cytoplasmic                   [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Cytoplasmic                   [matched 2494011: Cytoplasmic protein]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    Cytoplasmic            9.97
    Periplasmic            0.01
    CytoplasmicMembrane    0.01
    Extracellular          0.00
    OuterMembrane          0.00
  Final Prediction:
    Cytoplasmic            9.97

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>BPHYT_RS12455 FitnessBrowser__BFirm:BPHYT_RS12455
MFTRLREDIATIRERDPAARSAWEVLTCYPGLHALVLHRLAHACWRAKRRWFARFVSQMA
RFMTGIEIHPGATLGRRVFIDHGMGVVIGETAQIGDDCTIYQGVTLGGTSLTRGAKRHPT
LERGVIVGAGAKVLGGFTIGADAKIGSNAVVTKPVPARGTAVGNPARIIVPAAAAVAPEA
AVNAVSNGAACDVKRTAASSGFCAYGITPNADDPVSLAIHGLIDHAATQAKRIDEIVDAL
ERLGTSLEGLQGADAALLDLRRLSAAIAGKVEAAAAER

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory