PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on BPHYT_RS19370 FitnessBrowser__BFirm:BPHYT_RS19370 (265 amino acids)

SeqID: BPHYT_RS19370 FitnessBrowser__BFirm:BPHYT_RS19370
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [1 internal helix found]
    Motif-            Periplasmic                   [matched PS01039: SBP_BACTERIAL_3 Pattern - Periplasmic]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Periplasmic                   [matched 12231027: Periplasmic protein]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Non-Cytoplasmic               [Signal peptide detected]
  Localization Scores:
    Periplasmic            10.00
    Extracellular          0.00
    CytoplasmicMembrane    0.00
    OuterMembrane          0.00
    Cytoplasmic            0.00
  Final Prediction:
    Periplasmic            10.00

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>BPHYT_RS19370 FitnessBrowser__BFirm:BPHYT_RS19370
MNKAALALLGTLAGVLMHAGVAGAQTSATTATPSRLDEILARGTLRACTTGDYKPYSFYK
ADGQFEGIDIDMTESLAKSLGVKTEYIKTSWSNLMNDFVAKCDVGVGGVSPTLERQKRAF
FTQAYMVDGKTPIVRCDDVNKYQTVAQIDQPATRVIVNPGGTNERFAKQYFPHANLTVYP
DNVTIFKQILAGKADVMVTDASETLLQQKLNPGLCSVHPDKPFQYGEKAWLLPRGDVAFQ
QYVDQWLHLARATGEYQAISDKWLK