PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on BPHYT_RS29810 FitnessBrowser__BFirm:BPHYT_RS29810 (139 amino acids)

SeqID: BPHYT_RS29810 FitnessBrowser__BFirm:BPHYT_RS29810
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Cytoplasmic                   [matched 71152746: Serine acetyltransferase]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    Cytoplasmic            9.26
    Periplasmic            0.48
    CytoplasmicMembrane    0.24
    OuterMembrane          0.01
    Extracellular          0.01
  Final Prediction:
    Cytoplasmic            9.26

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>BPHYT_RS29810 FitnessBrowser__BFirm:BPHYT_RS29810
MLHIYRIAHLLHRLRVPFLPWALKVFNRIVFSVSLPPSVTVGRNVVFGYQGLGIVVHRQA
VLGNDIVISPNVVIGGRGQPGAPVIGDNVLIGAGACILGPVTIGQNVKIGANAVVTFDVP
PDVTVVGVPARIVQPRRSV