PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on BPHYT_RS32935 FitnessBrowser__BFirm:BPHYT_RS32935 (248 amino acids)

SeqID: BPHYT_RS32935 FitnessBrowser__BFirm:BPHYT_RS32935
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [1 internal helix found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Cytoplasmic                   [matched 130017: Acetoacetyl-CoA reductase]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Non-Cytoplasmic               [Signal peptide detected]
  Localization Scores:
    Periplasmic            6.49
    CytoplasmicMembrane    3.24
    Extracellular          0.14
    OuterMembrane          0.14
    Cytoplasmic            0.00
  Final Prediction:
    Unknown (This protein may have multiple localization sites.)

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>BPHYT_RS32935 FitnessBrowser__BFirm:BPHYT_RS32935
MANTLQGKIALVTGGSRGIGAATAIQLAAEGATVALSYSSSEAAAQEVIARIEASGGKAI
ALKADQADAKAVKALIAEVIERLGRIDILVNNAAVFVTGTVAETADTSAFERQVKINYEA
VVTAIREASRVMDSGGRIISISSALAWRSTWPGLADYSATKRAIEGYSKGAARDLGPKGI
TVNVIGTGSTNTEMNPDDSPFAEAQAAATALGRFGRPEEIASVIAFVASPAASFITGAII
PVDGGYSA